The domain within your query sequence starts at position 197 and ends at position 342; the E-value for the Speriolin_C domain shown below is 3e-65.
IVGEIAFQLDRRILAYVFPGVTRLYGFTVSNIPEKIKQTSIKSLDGSVDEKKLRELTHRY LTLTARLEKLGYSREVHPVFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDIVPPK FLGDSLLLLNCLCELSKEDSKPLFAW
Speriolin_C |
---|
PFAM accession number: | PF15059 |
---|---|
Interpro abstract (IPR029384): | This entry represents the C terminus of the sperm centrosome protein speriolin [ (PUBMED:15280373) (PUBMED:20542897) ]. Speriolin is a sperm centrosome protein [ (PUBMED:20542897) ] that form a complex with CDC20, CDC27 and TUBG1. It interacts with Cdc20 and is only detected in testis in humans [ (PUBMED:20542897) (PUBMED:15280373) ]. The function of speriolin and speriolin-like proteins is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Speriolin_C