The domain within your query sequence starts at position 208 and ends at position 253; the E-value for the Spin-Ssty domain shown below is 7.5e-24.
IGKHVEYTKEDGSKRTGKVIHQVKAKPSVYFIKFDDDFHIYVYDLV
Spin-Ssty |
---|
PFAM accession number: | PF02513 |
---|---|
Interpro abstract (IPR003671): | Spindlin (Spin) and Ssty were first identified for their involvement in gametogenesis. Spindlin was identified as a maternal transcript present in the unfertilised egg and early embryo, and was subsequently shown to interact with the spindle apparatus during oogenesis, and may therefore be important for mitosis [ (PUBMED:9053325) ]. In addition, spindlin appears to be a target for cell cycle-dependent phosphorylation, and as such may play a role in cell cycle regulation during the transition from gamete to embryo [ (PUBMED:11806826) ]. Ssty is a multi-copy, Y-linked spermatogenesis-specific transcript that appears to be required for normal spermatogenesis [ (PUBMED:15020475) ]. Ssty may play an analogous role to spindlin in sperm cells, namely during the transition from sperm cells to early embryo, and in mitosis. |
GO process: | gamete generation (GO:0007276) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spin-Ssty