The domain within your query sequence starts at position 100 and ends at position 174; the E-value for the Spindle_Spc25 domain shown below is 1.7e-27.
IRKIHGNKLQFIFTSIDPKNPESPYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTN NFSAFLANIRKAFIA
Spindle_Spc25 |
---|
PFAM accession number: | PF08234 |
---|---|
Interpro abstract (IPR013255): | This is a family of chromosome segregation proteins. It contains Spc25, which is a conserved eukaryotic kinetochore protein involved in cell division. In fungi the Spc25 protein is a subunit of the Nuf2-Ndc80 complex [ (PUBMED:15728720) ], and in vertebrates it forms part of the Ndc80 complex [ (PUBMED:14738735) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spindle_Spc25