The domain within your query sequence starts at position 133 and ends at position 207; the E-value for the Spindle_Spc25 domain shown below is 4.5e-24.

IRKIHGNKLQFIFTSIDPKNPESPYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTN
NFSAFLANIRKAFIA

Spindle_Spc25

Spindle_Spc25
PFAM accession number:PF08234
Interpro abstract (IPR013255):

This is a family of chromosome segregation proteins. It contains Spc25, which is a conserved eukaryotic kinetochore protein involved in cell division. In fungi the Spc25 protein is a subunit of the Nuf2-Ndc80 complex [ (PUBMED:15728720) ], and in vertebrates it forms part of the Ndc80 complex [ (PUBMED:14738735) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spindle_Spc25