SMART: Pfam domain Stealth

The domain within your query sequence starts at position 934 and ends at position 982; the E-value for the Stealth_CR3 domain shown below is 2.9e-21.

AHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMS

Stealth_CR3

PFAM accession number:	PF17102
Interpro abstract (IPR031357):	This entry represents the third of several highly conserved regions on stealth proteins from animals and bacteria. There are up to four CR regions on all member proteins. The domain is found in tandem with CR1, CR2 and CR4 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system [ (PUBMED:16299590) ].

PFAM accession number:

PF17102

Interpro abstract (IPR031357):

This entry represents the third of several highly conserved regions on stealth proteins from animals and bacteria. There are up to four CR regions on all member proteins. The domain is found in tandem with CR1, CR2 and CR4 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system [ (PUBMED:16299590) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stealth_CR3