SMART: Pfam domain Stealth

The domain within your query sequence starts at position 1117 and ends at position 1173; the E-value for the Stealth_CR4 domain shown below is 7.9e-28.

DDIRKNPRKFVCLNDNIDHNHKDARTVKAVLRDFYESMFPIPSQFELPREYRNRFLH

Stealth_CR4

PFAM accession number:	PF17103
Interpro abstract (IPR031356):	This entry represents a fourth conserved region on stealth proteins from animals and bacteria. There are four CR regions on mammalian members. CR4 carries a well-conserved CLND sequence-motif. The domain is found in tandem with CR1, CR2 and CR3 on both potential metazoan hosts and on pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains also appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system [ (PUBMED:16299590) ].

PFAM accession number:

PF17103

Interpro abstract (IPR031356):

This entry represents a fourth conserved region on stealth proteins from animals and bacteria. There are four CR regions on mammalian members. CR4 carries a well-conserved CLND sequence-motif. The domain is found in tandem with CR1, CR2 and CR3 on both potential metazoan hosts and on pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains also appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system [ (PUBMED:16299590) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stealth_CR4