The domain within your query sequence starts at position 193 and ends at position 336; the E-value for the Succ_CoA_lig domain shown below is 6.7e-11.
KGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGI ILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAK EKISALQSAGVVVSMSPAQLGTTI
Succ_CoA_lig |
![]() |
---|
PFAM accession number: | PF13607 |
---|---|
Interpro abstract (IPR032875): | This domain contains the catalytic domain from Succinyl-CoA ligase alpha subunit and other related enzymes. A conserved histidine is involved in phosphoryl transfer [ (PUBMED:11781092) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Succ_CoA_lig