The domain within your query sequence starts at position 369 and ends at position 524; the E-value for the Sulfotransfer_1 domain shown below is 1.1e-12.
EPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFEN CMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYT MHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRS
Sulfotransfer_1 |
![]() |
---|
PFAM accession number: | PF00685 |
---|---|
Interpro abstract (IPR000863): | This entry includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase. These enzymes are responsible for the transfer of sulphate groups to specific compounds [ (PUBMED:9360604) ]. |
GO function: | sulfotransferase activity (GO:0008146) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sulfotransfer_1