The domain within your query sequence starts at position 63 and ends at position 143; the E-value for the Swi3 domain shown below is 2.8e-36.
KLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFID RVENLGNKKEVQTCLKRIRLD
Swi3 |
 |
|---|
| PFAM accession number: | PF07962 |
|---|---|
| Interpro abstract (IPR012923): | This entry represents a domain found in a group of proteins, including Csm3 from budding yeasts, Swi3 from fission yeasts and TIPIN from animals. They are involved in DNA replication and the maintenance of replication fork stability [ (PUBMED:15367656) (PUBMED:22842922) (PUBMED:17116885) ]. |
| GO process: | replication fork protection (GO:0048478), cellular response to DNA damage stimulus (GO:0006974) |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Swi3