The domain within your query sequence starts at position 46 and ends at position 137; the E-value for the Sybindin domain shown below is 8.7e-13.

LDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDL
YIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKH

Sybindin

Sybindin
PFAM accession number:PF04099
Interpro abstract (IPR007233):

This entry includes a group of trafficking protein particle complex subunit (TRAPPC) proteins, such as TPPC1/4 from humans and Trs23/Bet5 from yeasts.

Budding yeast Trs23 and Bet5 are components of the TRAPP I, TRAPP II and TRAPP III. TRAPP complexes are guanine nucleotide exchange factors (GEF) for the GTPase Ypt1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. RAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation [ (PUBMED:11239471) (PUBMED:20972447) (PUBMED:20375281) ].

GO process:vesicle-mediated transport (GO:0016192)
GO component:TRAPP complex (GO:0030008)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sybindin