The domain within your query sequence starts at position 142 and ends at position 439; the E-value for the Syntaphilin domain shown below is 4.4e-140.

RNPLSPSNIHPSYAPSSPSSSNSGSYKGSDCSPVMRRSGRYMSCGENHGVKPPNPEQYLT
PLQQKEVTVRHLRTKLKESERRLHERESEIMELKSQLARMREDWIEEECHRVEAQLALKE
ARKEIKQLKQVIETMRSSLADKDKGIQKYFVDINIQNKKLESLLQSMEMAHNSSLRDELC
LDFSFDSPEKSLPLSSTFDKLPDGLSLEEQITEEGADSELLVGDSMAEGTDLLDEMVTAT
TTESSGLEFVHSTPGPQALKALPLVSHEEGIAVMEQAVQTDVVPFSPAISELIQSVLK

Syntaphilin

 Syntaphilin
PFAM accession number:PF15290
Interpro abstract (IPR028197):

Syntaphilin is selectively expressed in the brain. It competes with SNAP-25 for binding to syntaxin-1 and inhibits SNARE complex formation by absorbing free syntaxin-1. In this way, syntaphilin may function as a molecular clamp, controlling free syntaxin-1 availability for the assembly of the SNARE complex, thereby regulating synaptic vesicle exocytosis [ (PUBMED:10707983) ].

Syntabulin is a microtubule-associated protein that has been implicated in syntaxin transport in neurons. It appears to function as a linker molecule that attaches syntaxin-cargo vesicles to kinesin I, enabling the transport of syntaxin-1 to neuronal processes [ (PUBMED:15459722) ].

This family consists of the eukaryotic proteins syntaphilin and syntabulin.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syntaphilin