The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the Syntaxin domain shown below is 1.3e-28.

MDGFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRI
RGKLKSIEQSCDQDENGNRTSVDLR

Syntaxin

Syntaxin
PFAM accession number:PF00804
Interpro abstract (IPR006011):

Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins and an N-terminal domain that is featured in this entry. This domain varies between syntaxin isoforms; in syntaxin 1A ( O35526 ) it is found as three alpha-helices with a left-handed twist. It may fold back on the SNARE domain to allow the molecule to adopt a 'closed' configuration that prevents formation of the core fusion complex - it thus has an auto-inhibitory role.

The function of syntaxins is determined by their localisation. They are involved in neuronal exocytosis, ER-Golgi transport and Golgi-endosome transport, for example. They also interact with other proteins as well as those involved in SNARE complexes. These include vesicle coat proteins, Rab GTPases, and tethering factors [ (PUBMED:11737951) ].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syntaxin