SMART: Pfam domain Syntaxin-18

The domain within your query sequence starts at position 3 and ends at position 96; the E-value for the Syntaxin-18_N domain shown below is 3.4e-24.

VDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRPKGDFSSRAREVISHIGK
LRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQI

Syntaxin-18_N

PFAM accession number:	PF10496
Interpro abstract (IPR019529):	This is the conserved N-terminal of Syntaxin-18. Syntaxin-18 is found in the SNARE complex of the endoplasmic reticulum and functions in the trafficking between the ER intermediate compartment and the cis-Golgi vesicle. In particular, the N-terminal region is important for the formation of ER aggregates [ (PUBMED:10788491) ]. More specifically, syntaxin-18 is involved in endoplasmic reticulum-mediated phagocytosis, presumably by regulating the specific and direct fusion of the ER with the plasma or phagosomal membranes [ (PUBMED:16790498) ].

PFAM accession number:

PF10496

Interpro abstract (IPR019529):

This is the conserved N-terminal of Syntaxin-18. Syntaxin-18 is found in the SNARE complex of the endoplasmic reticulum and functions in the trafficking between the ER intermediate compartment and the cis-Golgi vesicle. In particular, the N-terminal region is important for the formation of ER aggregates [ (PUBMED:10788491) ]. More specifically, syntaxin-18 is involved in endoplasmic reticulum-mediated phagocytosis, presumably by regulating the specific and direct fusion of the ER with the plasma or phagosomal membranes [ (PUBMED:16790498) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syntaxin-18_N