The domain within your query sequence starts at position 3 and ends at position 96; the E-value for the Syntaxin-18_N domain shown below is 4.1e-26.
VDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRPKGDFSSRAREVISHIGK LRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQI
Syntaxin-18_N |
![]() |
---|
PFAM accession number: | PF10496 |
---|---|
Interpro abstract (IPR019529): | This is the conserved N-terminal of Syntaxin-18. Syntaxin-18 is found in the SNARE complex of the endoplasmic reticulum and functions in the trafficking between the ER intermediate compartment and the cis-Golgi vesicle. In particular, the N-terminal region is important for the formation of ER aggregates [ (PUBMED:10788491) ]. More specifically, syntaxin-18 is involved in endoplasmic reticulum-mediated phagocytosis, presumably by regulating the specific and direct fusion of the ER with the plasma or phagosomal membranes [ (PUBMED:16790498) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syntaxin-18_N