The domain within your query sequence starts at position 5 and ends at position 103; the E-value for the Syntaxin-6_N domain shown below is 5.1e-35.
DPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLEDL DETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMK
Syntaxin-6_N |
![]() |
---|
PFAM accession number: | PF09177 |
---|---|
Interpro abstract (IPR015260): | This domain is found in the N-terminal of various SNARE proteins, adopt a structure consisting of an antiparallel three-helix bundle. Its exact function has not been determined, though it is known that it regulates the SNARE motif, as well as mediate various protein-protein interactions involved in membrane-transport [ (PUBMED:12082176) ]. |
GO process: | Golgi vesicle transport (GO:0048193) |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Syntaxin-6_N