The domain within your query sequence starts at position 610 and ends at position 852; the E-value for the TAF4 domain shown below is 4e-72.
INDVTFMAEVNLDEENACILAAHSDFVGTLIQSCKEEPFLVIGALQKRILDIGKKHDITE LNSDAVNLISHATQERLRGLLEKLTTIAQHRMTIYKGSENYILSTDTRSQLKFLEKLDQL EKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDANLTALAAIG PRKKRPLESGNESFKDNPSTSGTSSLTATKPFRPRITRICLRDLIFCMEQEREMKYSRAL YLA
TAF4 |
---|
PFAM accession number: | PF05236 |
---|---|
Interpro abstract (IPR007900): | Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site. Transcription factor TFIID is one of the general factors involved in this process. Yeast TFIID comprises the TATA binding protein and 14 TBP-associated factors (TAFIIs), nine of which contain histone-fold domains. The C-terminal region of the TFIID-specific yeast TAF4 (yTAF4) containing the HFD shares strong sequence similarity with Drosophila (d)TAF4 and human TAF4. A structure/function analysis of yTAF4 demonstrates that the HFD, a short conserved C-terminal domain (CCTD), and the region separating them are all required for yTAF4 function. This region of similarity is found in Transcription initiation factor TFIID component TAF4 [ (PUBMED:12237303) ]. TAF4 domain interacts with TAF12 and makes a novel histone-like heterodimer that binds DNA and has a core promoter function of a subset of genes [ (PUBMED:19635797) (PUBMED:12237304) ]. |
GO process: | DNA-templated transcription, initiation (GO:0006352) |
GO component: | transcription factor TFIID complex (GO:0005669) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF4