The domain within your query sequence starts at position 111 and ends at position 185; the E-value for the TAFH domain shown below is 3.7e-33.
ARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHAKLQEATNFPLRP FVIPFLKANLPLLQR
TAFH |
![]() |
---|
PFAM accession number: | PF07531 |
---|---|
Interpro abstract (IPR003894): | The TAF homology (TAFH) or Nervy homology region 1 (NHR1) domain is a domain of 95-100 amino acids present in eukaryotic proteins of the MTG/ETO family and whereof the core ~75-80 residues occur in TAF proteins. The transcription initiation TFIID complex is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). The TAFH/NHR1 domain is named after fruit fly TATA-box-associated factor 110 (TAF110), human TAF105 and TAF130, and the fruit fly protein Nervy, which is a homologue of human MTG8/ETO [ (PUBMED:9447981) (PUBMED:9790752) ]. The human eight twenty-one (ETO, MTG8 or CBFA2T1) and related myeloid transforming gene products MTGR1 and MTG16 as well as the Nervy protein contain the NHR1-4 domains. The NHR1/TAFH domain occurs in the N-terminal part of these proteins, while a MYND-type zinc finger forms the NHR4 domain [ (PUBMED:12559562) ]. The TAFH/NHR1 domain can be involved in protein-protein interactions, e.g in MTG8/ETO with HSP90 and Gfi-1 [ (PUBMED:10076566) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAFH