The domain within your query sequence starts at position 21 and ends at position 111; the E-value for the TAFII55_N domain shown below is 7.2e-36.
VEEQFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLP CVIGSLKTIDRKTFYKTADVSQMLVCSPEVT
TAFII55_N |
---|
PFAM accession number: | PF04658 |
---|---|
Interpro abstract (IPR006751): | The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits its acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminal of the protein [ (PUBMED:11592977) ]. |
GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367) |
GO component: | transcription factor TFIID complex (GO:0005669) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAFII55_N