The domain within your query sequence starts at position 54 and ends at position 206; the E-value for the TCRP1 domain shown below is 1.1e-89.
IEPRVLHMLGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGT YYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGSGVTMGMVAGTTMAMSAGTLL TAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
TCRP1 |
![]() |
---|
PFAM accession number: | PF14944 |
---|---|
Interpro abstract (IPR029247): | The FAM168 family consists of FAM168A and FAM168B. The function of FAM168A is unknown, but FAM168B has been renamed as myelin-associated neurite-outgrowth inhibitor (MANI), as it is an inhibitor of neuronal axonal outgrowth [ (PUBMED:20716133) ]. MANI interacts with cell division cycle protein 27 (Cdc27) [ (PUBMED:22771904) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TCRP1