The domain within your query sequence starts at position 35 and ends at position 182; the E-value for the TDRP domain shown below is 1.8e-72.
GASLRGWKEATSLFNKDDEEHLLETSRSPKSKGTNQRLREELKAEKKSGFWDALVLKQNA QPKKPDQIEGWEPPKLTAEDVVADHTEDDRSGCPPWSAWEDDTKGSTKYTSLANSASSSR WSLRSAGKLVSIRRQSKGHLTETCEEGE
TDRP |
---|
PFAM accession number: | PF15683 |
---|---|
Interpro abstract (IPR031399): | TDRP is a family of proteins found in chordates. It is predominantly expressed in the testis, distributed in both cytoplasm and the nuclei of spermatogenic cells. It may act as a nuclear factor with an important role in spermatogenesis [ (PUBMED:20170638) ]. |
GO process: | spermatogenesis (GO:0007283) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TDRP