The domain within your query sequence starts at position 2 and ends at position 55; the E-value for the TEA domain shown below is 1.1e-18.

TSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPC

TEA

 TEA
PFAM accession number:PF01285
Interpro abstract (IPR000818):

The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and abaA. The TEA domain is located toward the amino terminus of eukaryotic transcription factors of the TEA/ATTS family. It is predicted to contain three alpha-helices, two of which have been demonstrated to be important for DNA binding [ (PUBMED:8389695) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEA