The domain within your query sequence starts at position 3 and ends at position 152; the E-value for the TEX13 domain shown below is 2.3e-66.
CEDVTTGFRHARVLMFINEQMAKHSRGPEFYLENLTLSWEEVEEKLNVLLDGTEVPRDVQ EACAWSSLALGVRFAFRQGQLQGRRVQWLHDFASLHRSAAHALALDLKKLTDQHEIERKE AAYQLLLAHTKLAEVQRERDLMRLKLLHAR
TEX13 |
---|
PFAM accession number: | PF15186 |
---|---|
Interpro abstract (IPR028193): | The function of this family of proteins has not, as yet, been determined. However, members are thought to be encoded for by spermatogonially-expressed, germ-cell-specific genes [ (PUBMED:14531651) ]. This family of proteins is found in eukaryotes. Proteins in this family are typically between 177 and 384 amino acids in length. There are two conserved sequence motifs: FIN and LAL. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX13