The domain within your query sequence starts at position 13 and ends at position 88; the E-value for the TEX29 domain shown below is 9.6e-47.
HLLKKFAVCDIPLYDICDYNVTRERCRSLDCCFYRGVCYEKAVPIYVQVFFTLIWFVAGA FIIAVIYRVIQGTKKE
TEX29 |
 |
|---|
| PFAM accession number: | PF15839 |
|---|---|
| Interpro abstract (IPR031685): | TEX29, testis-expressed sequence 29 protein, is a family of proteins found in eukaryotes. Proteins in this family are typically between 39 and 150 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX29