The domain within your query sequence starts at position 59 and ends at position 126; the E-value for the TFIID_20kDa domain shown below is 6.1e-40.

TKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQL
HLERQWNM

TFIID_20kDa

TFIID_20kDa
PFAM accession number:PF03847
Interpro abstract (IPR003228):

TFIID is one of several General Transcription Factors (GTFs), which also include TFIIA, TFIIB, TFIIE, TFIIF and TFIIH, that are involved in the accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the pre-initiation complex. Human transcription initiation factor TFIID is composed of the TATA-binding protein (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [ (PUBMED:7667268) (PUBMED:10664584) ].

TBP-associated factor 12 (TAF12) is one of several TAFs that bind TBP and are involved in forming the TFIID complex. TAF12 interacts with TAF4 and makes a novel histone-like heterodimer that binds DNA and has a core promoter function of a subset of genes [ (PUBMED:19635797) ].

This entry represents a domain found in TAF12.

GO process:DNA-templated transcription, initiation (GO:0006352)
GO component:transcription factor TFIID complex (GO:0005669)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIID_20kDa