The domain within your query sequence starts at position 73 and ends at position 146; the E-value for the TFIIE_beta domain shown below is 1.7e-27.
GYKFGVLAKIVNYMKTRHQRGDTHPLTLEEILDETQHLDIGLKQKQWLMTEALVNNPKIE VVDGKYAFKPKYNL
TFIIE_beta |
![]() |
---|
PFAM accession number: | PF02186 |
---|---|
Interpro abstract (IPR003166): | Initiation of eukaryotic mRNA transcription requires melting of promoter DNA with the help of the general transcription factors TFIIE and TFIIH. In higher eukaryotes, the general transcription factor TFIIE consists of two subunits: the large alpha subunit ( IPR002853 ) and the small beta ( IPR003166 ). TFIIE beta has been found to bind to the region where the promoter starts to open to be single-stranded upon transcription initiation by RNA polymerase II. The approximately 120-residue central core domain of TFIIE beta plays a role in double-stranded DNA binding of TFIIE [ (PUBMED:10716934) ]. The TFIIE beta central core DNA-binding domain consists of three helices with a beta hairpin at the C terminus, resembling the winged helix proteins. It shows a novel double-stranded DNA-binding activity where the DNA-binding surface locates on the opposite side to the previously reported winged helix motif by forming a positively charged furrow [ (PUBMED:10716934) ]. This entry represents the central core DNA-binding domain of the TFIIE beta subunit. Transcription Factor IIE (TFIIE) beta winged-helix (or forkhead) domain is located at the central core region of TFIIE beta. The winged-helix is a form of helix-turn-helix (HTH) domain which typically binds DNA with the 3rd helix. The winged-helix domain is distinguished by the presence of a C-terminal beta-strand hairpin unit (the wing) that packs against the cleft of the tri-helical core. Although most winged-helix domains are multi-member families, TFIIE beta winged-helix domain is typically found as a single orthologous group. [ (PUBMED:15808743) (PUBMED:10716934) (PUBMED:19210545) (PUBMED:9348072) ]. |
GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIE_beta