The domain within your query sequence starts at position 1 and ends at position 39; the E-value for the THRAP3_BCLAF1 domain shown below is 4e-17.
XHHFGSSGMTLHERFTKYLKRGNEQEAAKNKKSPEIHRE
THRAP3_BCLAF1 |
![]() |
---|
PFAM accession number: | PF15440 |
---|---|
Interpro abstract (IPR029199): | This family includes thyroid hormone receptor-associated protein 3 (THRAP3), which is a spliceosome component and a subunit of the TRAP complex which plays a role in pre-mRNA splicing and mRNA decay [ (PUBMED:20123736) ]. It also includes the transcriptional repressor Bcl-2-associated transcription factor 1 (BCLAF1) [ (PUBMED:10330179) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry THRAP3_BCLAF1