The domain within your query sequence starts at position 1278 and ends at position 1334; the E-value for the TIL domain shown below is 7e-13.

CEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAAC

TIL

• PFAM accession number: PF01826
• Interpro abstract (IPR002919):

  This domain is found in proteinase inhibitors, as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIL