The domain within your query sequence starts at position 20 and ends at position 159; the E-value for the TINF2_N domain shown below is 1.8e-41.

WLVVRRRRVEHFPKVVEFLQSLRAAAPGLVCYRHHERLCMSLKAKVVVELILQARPWDQV
LNALKHHFPAESRTTKEDRKLLEARENFCLLVKHLSEDPPSSLQELEQDYGESFLVAMEK
LLFEYLCQLEKALPPVRAQE

TINF2_N

TINF2_N
PFAM accession number:PF14973
Interpro abstract (IPR029400):

This entry represents the N-terminal domain of TERF1-interacting nuclear factor 2 (TINF2). It is a component of the shelterin complex (telosome), which is involved in the protection and maintenance of telomeres [ (PUBMED:16166375) (PUBMED:16880378) (PUBMED:22201831) ]. TINF2 plays a role in shelterin complex assembly [ (PUBMED:16880378) ]. In humans, one of its isoforms may have an additional role in tethering telomeres to the nuclear matrix [ (PUBMED:19229133) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TINF2_N