The domain within your query sequence starts at position 49 and ends at position 99; the E-value for the TIP39 domain shown below is 5e-33.
RAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDA
TIP39 |
 |
|---|
| PFAM accession number: | PF14980 |
|---|---|
| Interpro abstract (IPR029396): | This entry represents Tuberoinfundibular peptide of 39 residues (TIP39), which is a potent and selective agonist of the parathyroid hormone 2 receptor (PTH2R) [ (PUBMED:12559132) ]. In human, TIP39 expression was detected by RT-PCR in the brain, trachea, fetal liver, kidney and heart. In the brain, TIP39 is expressed in only three sites, the medial and lateral parts of the subparafascicular area in the caudal thalamus, and the medial paralemnsical nucleus in the lateral pons [ (PUBMED:19401215) ]. The TIP39-PTH2R system is a unique neuropeptide-receptor system that plays a role in limbic, endocrine, viscerosensory, and auditory functions [ (PUBMED:19857544) ]. |
| GO process: | neuropeptide signaling pathway (GO:0007218) |
| GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIP39