The domain within your query sequence starts at position 1 and ends at position 83; the E-value for the TLE_N domain shown below is 1.2e-37.
YYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAII GVRGLPNLPLTQQQLQAQHLSHA
TLE_N |
![]() |
---|
PFAM accession number: | PF03920 |
---|---|
Interpro abstract (IPR005617): | The N-terminal domain of the Grouch/TLE co-repressor proteins are involved in oligomerisation. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TLE_N