The domain within your query sequence starts at position 81 and ends at position 154; the E-value for the TLE_N domain shown below is 4.3e-34.
LSPLQYYEMSYGLNIEMHKQAEIVKRLSAICAQMVPFLTQEHQQQVLQAVDRAKQVTVGE LNSLLGQQNQLQPL
TLE_N |
 |
|---|
| PFAM accession number: | PF03920 |
|---|---|
| Interpro abstract (IPR005617): | The N-terminal domain of the Grouch/TLE co-repressor proteins are involved in oligomerisation. |
| GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TLE_N