The domain within your query sequence starts at position 1 and ends at position 50; the E-value for the TM2 domain shown below is 1e-10.

MAKGLLMTYVLWALGGPVGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFW

TM2

• PFAM accession number: PF05154
• Interpro abstract (IPR007829):

  This domain is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TM2