The domain within your query sequence starts at position 196 and ends at position 245; the E-value for the TM2 domain shown below is 6.3e-17.
GGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVL
TM2 |
![]() |
---|
PFAM accession number: | PF05154 |
---|---|
Interpro abstract (IPR007829): | This domain is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TM2