The domain within your query sequence starts at position 1 and ends at position 112; the E-value for the TMEM132 domain shown below is 6.2e-31.

XADFMKLESPHIATLQDSRVLVGREVGMTTIQVLSPLSDSILAEKTVTVLDDKVSVTDLA
VQVVAGLSVTLHPISENNKATSAVAMAEELLRAPKKQQRMVGFQKFESLTQQ

TMEM132

TMEM132
PFAM accession number:PF16070
Interpro abstract (IPR031437):

This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development [ (PUBMED:12514190) ]. TMEM132D may be a marker for oligodendrocyte differentiation [ (PUBMED:12966072) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM132