The domain within your query sequence starts at position 1 and ends at position 112; the E-value for the TMEM132 domain shown below is 6.2e-31.
XADFMKLESPHIATLQDSRVLVGREVGMTTIQVLSPLSDSILAEKTVTVLDDKVSVTDLA VQVVAGLSVTLHPISENNKATSAVAMAEELLRAPKKQQRMVGFQKFESLTQQ
TMEM132 |
---|
PFAM accession number: | PF16070 |
---|---|
Interpro abstract (IPR031437): | This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development [ (PUBMED:12514190) ]. TMEM132D may be a marker for oligodendrocyte differentiation [ (PUBMED:12966072) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM132