The domain within your query sequence starts at position 892 and ends at position 980; the E-value for the TMEM132D_C domain shown below is 2.4e-39.
TNFPAHVDLPKAKTRGTLEENGLMQTAHGLSDLEIGMYALLGVFCLAILVFLINCATFAF KYRHKQVPLEGQASMTHSHDWVWLGNEAE
TMEM132D_C |
---|
PFAM accession number: | PF15706 |
---|---|
Interpro abstract (IPR031436): | This entry represents the C-terminal domain found in members of the transmembrane protein 132 family. The family consists of TMEM132A, TMEM132B, TMEM132C, TMEM132D, TMEM132E. TMEM132A may play a role in embryonic and postnatal development of the brain. It increased resistance to cell death induced by serum starvation in cultured cells. It regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation [ (PUBMED:12514190) (PUBMED:16806201) ]. TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation [ (PUBMED:12966072) (PUBMED:16806201) ]. Additionally, as it may be most strongly expressed in neurons and it colocalises with actin filaments, TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour [ (PUBMED:22948381) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM132D_C