The domain within your query sequence starts at position 58 and ends at position 187; the E-value for the TMEM132D_N domain shown below is 1.2e-54.

VSFHVLRAETAFFLKEANPDPLRNASLQSRVESFFIYKAQQPPVLNVSYGPYSAEKVIPL
DLMLNPNFLGPTSKFPFDWRLKAYILQEKVYLSHPKVQVLFHIVGRDWDDHRDEKLPCLR
VFAFRDSREV

TMEM132D_N

TMEM132D_N
PFAM accession number:PF15705
Interpro abstract (IPR031435):

This entry represents the N-terminal domain found in members of the transmembrane protein 132 family. The family consists of TMEM132A, TMEM132B, TMEM132C, TMEM132D, TMEM132E.

TMEM132A may play a role in embryonic and postnatal development of the brain. It increased resistance to cell death induced by serum starvation in cultured cells. It regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation [ (PUBMED:12514190) (PUBMED:16806201) ].

TMEM132D is a single-pass transmembrane protein that is highly expressed in the cortical regions of the human and mouse brain. The function is still unknown. It may act as a cell-surface marker for oligodendrocyte differentiation [ (PUBMED:12966072) (PUBMED:16806201) ]. Additionally, as it may be most strongly expressed in neurons and it colocalises with actin filaments, TMEM132D may be implicated in neuronal sprouting and connectivity in brain regions important for anxiety-related behaviour [ (PUBMED:22948381) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM132D_N