The domain within your query sequence starts at position 1 and ends at position 126; the E-value for the TMEM164 domain shown below is 6.1e-67.
MHMLNGALLALLFPVVNTRLLPFELEIYYIQHAMLYVVPVYLLWKGGAYTPEPLCNFQWA LLSTGLMFFYHFSFLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGK LVILFS
TMEM164 |
---|
PFAM accession number: | PF14808 |
---|---|
Interpro abstract (IPR026508): | This entry represents the transmembrane protein 164 family. The function of these proteins is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM164