The domain within your query sequence starts at position 182 and ends at position 302; the E-value for the TMEM191C domain shown below is 1.5e-68.
MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRLWALSA LQTLLLLPLGFLVLPLIYVVLAKPDAVGPGLQSLGSDAVFRRLRYTLSPLLELRARGLLP A
TMEM191C |
![]() |
---|
PFAM accession number: | PF15194 |
---|---|
Interpro abstract (IPR028186): | Proteins in this family are uncharacterised single-pass membrane proteins found in eukaryotes. Proteins in this family are typically between and 302 amino acids in length. There are two conserved sequence motifs: QDC and RLF. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM191C