The domain within your query sequence starts at position 49 and ends at position 127; the E-value for the TMEM213 domain shown below is 7.2e-45.
ETSSSNSTLSAHHPDPGTLEQCANVDFCPLASLCCRASVDEYGWIAAAVGWSFWFLTLIL LCVDKLMKLTPEEPKDLAA
TMEM213 |
---|
PFAM accession number: | PF15192 |
---|---|
Interpro abstract (IPR028121): | This family of proteins is found in eukaryotes. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM213