The domain within your query sequence starts at position 116 and ends at position 216; the E-value for the TMEM219 domain shown below is 1.6e-9.

HVVGLLTTLNFGDGPDRNKTQTFQAKIHGSQIGLTGSSAGESVLVTARVASGRTPGTCLY
FSGVPKVLPSSQPPISCSEEGVGNATLSPVMGEECVRVWSH

TMEM219

TMEM219
PFAM accession number:PF14940
Interpro abstract (IPR039587):

Proteins containing this domain include TMEM248 and TMEM219 (also known as insulin-like growth factor-binding protein 3 receptor, IGFBP-3R) from animals. TMEM219 is a cell death receptor and is essential for the IGFBP-3-induced apoptosis and tumor suppression [ (PUBMED:20353938) ]. The function of TMEM248 is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM219