The domain within your query sequence starts at position 23 and ends at position 122; the E-value for the TMEM220 domain shown below is 4e-30.
FFALAAVVQVNDPDAELWVVVYMIPAVLTLLVGFNPLVTGNFIWKSVSAIHMLFCALWAG GLAYHFLLHAKQNLLNEEEGRELSGLVIVTAWMALCHSSS
TMEM220 |
 |
|---|
| PFAM accession number: | PF15071 |
|---|---|
| Interpro abstract (IPR029377): | This entry represents the transmembrane 220 (TMEM220), which contains a transmembrane helix. The length of this protein is typically between 150 and 160 amino acids. In humans, it is found in the chromosomal position 17p13.1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM220