The domain within your query sequence starts at position 64 and ends at position 144; the E-value for the TMEM220 domain shown below is 4.3e-19.
MTVVYMIPAVLTLLVGFNPLVTGNFIWKSVSAIHMLFCALWAGGLAYHFLLHAKQNLLNE EEGRELSGLVIVTAWMALCHS
TMEM220 |
![]() |
---|
PFAM accession number: | PF15071 |
---|---|
Interpro abstract (IPR029377): | This entry represents the transmembrane 220 (TMEM220), which contains a transmembrane helix. The length of this protein is typically between 150 and 160 amino acids. In humans, it is found in the chromosomal position 17p13.1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM220