The domain within your query sequence starts at position 28 and ends at position 166; the E-value for the TMEM252 domain shown below is 5.2e-73.
ISNSIFHSQRNLVVAYVLLPMGFVILLSGIFWGTYRQANENKEMFNHVLRQHLAFQDLPL ATVDRPDFYPPAYEESLDVEKQACPAGRELLGFPPPLYTETNLEFEHLEDPQPEAPPPYQ EIIADAGAPAKAQDAEEPS
TMEM252 |
---|
PFAM accession number: | PF15664 |
---|---|
Interpro abstract (IPR031363): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 152 and 182 amino acids in length. Their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM252