The domain within your query sequence starts at position 7 and ends at position 189; the E-value for the TMEM37 domain shown below is 4.1e-97.
QAHKLLGLKRPHRSFFESFIRTLIIVCTALAVVLSSVSICDGHWLLVEDHLFGLWYFCTI GNHSEPHCLRDLSQAHMPGLAVGMGLARSVAAMAVVAAIFGLEMLIVSQVCEDVRSRRKW AIGSYLLLVAFILSSGGLLTFIILLKNQINLLGFTLMFWCEFTASFLFFLNAASGLHINS LTQ
TMEM37 |
---|
PFAM accession number: | PF15108 |
---|---|
Interpro abstract (IPR029372): | Voltage-dependent calcium channel gamma-like subunit (also known as Tmem37) has a role in stabilising the calcium channel in an inactivated (closed) state. It is a subunit of the L-type calcium channels that modulate calcium current when coexpressed with CACNA1G (calcium channel, voltage-dependent, T type, alpha 1G subunit) [ (PUBMED:10734232) ]. |
GO component: | integral component of membrane (GO:0016021) |
GO function: | calcium channel activity (GO:0005262), voltage-gated ion channel activity (GO:0005244) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM37