The domain within your query sequence starts at position 1 and ends at position 152; the E-value for the TMEM71 domain shown below is 1.9e-85.
MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSSFECCSIDPLTGSHYI CRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLVRIFRKKKRTHRSLSSL LDPRASKSWLHGSIFGEVDSLPSEDLWLDGIR
TMEM71 |
![]() |
---|
PFAM accession number: | PF15121 |
---|---|
Interpro abstract (IPR027975): | The function of this family, TMEM71, is not known. However, it is predicted to be a transmembrane protein. This family of proteins is found in eukaryotes. Proteins in the family vary between 41 and 291 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM71