The domain within your query sequence starts at position 555 and ends at position 630; the E-value for the TORC_C domain shown below is 9.2e-36.
PNIILTVTGESPPSLSKELSSTLAGVSDVSFDSDHQFPLDELKIDPLTLDGLHMLNDPDM VLADPATEDTFRMDRL
TORC_C |
![]() |
---|
PFAM accession number: | PF12886 |
---|---|
Interpro abstract (IPR024785): | This entry represents the C-terminal domain of TORC proteins. TORC (transducer of regulated CREB activity) is a protein family of coactivators that enhances the activity of CRE-dependent transcription via a phosphorylation-independent interaction with the bZIP DNA binding/dimerisation domain of CREB (cAMP Response Element-Binding) [ (PUBMED:14536081) ]. The C-terminal domain is negatively charged, resembling transcription activation domains, and experimental studies indicate that it may play a role in activation of transcription [ (PUBMED:14506290) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TORC_C