The domain within your query sequence starts at position 6 and ends at position 66; the E-value for the TORC_N domain shown below is 1.1e-26.
NPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSL P
TORC_N |
 |
|---|
| PFAM accession number: | PF12884 |
|---|---|
| Interpro abstract (IPR024783): | This entry represents the N-terminal domain of TORC proteins. TORC (transducer of regulated CREB activity) is a protein family of coactivators that enhances the activity of CRE-dependent transcription via a phosphorylation-independent interaction with the bZIP DNA binding/dimerisation domain of CREB (cAMP Response Element-Binding) [ (PUBMED:14536081) ]. The proteins display a highly conserved predicted N-terminal coiled-coil domain and an invariant sequence matching a protein kinase A (PKA) phosphorylation consensus sequence (RKXS) [ (PUBMED:14506290) ]. The coiled-coil structure interacts with the bZIP domain of CREB [ (PUBMED:14536081) ]. This interaction may occur via ionic bonds because it is disrupted under high-salt conditions [ (PUBMED:17565599) ]. In addition to CREB-binding, the N-terminal domain plays a role in the tetramer formation of TORCs [ (PUBMED:14536081) ], but the physiological function of the multimeric complex has not been clarified yet. |
| GO process: | protein homotetramerization (GO:0051289) |
| GO function: | cAMP response element binding protein binding (GO:0008140) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TORC_N