The domain within your query sequence starts at position 2 and ends at position 52; the E-value for the TP1 domain shown below is 1.7e-33.
STSRKLKTHGMRRGKNRAPHKGVKRGGSKRKYRKSVLKSRKRGDDASRNYR
TP1 |
 |
|---|
| PFAM accession number: | PF02079 |
|---|---|
| Interpro abstract (IPR001319): | Nuclear transition protein 1 (TP1) is one of the spermatid-specific proteins [ (PUBMED:2040274) ]. TP1 is a basic protein well conserved in mammalian species. In mammals, the second stage of spermatogenesis is characterised by the conversion of nucleosomal chromatin to the compact, non-nucleosomal and transcriptionally inactive form found in the sperm nucleus. This condensation is associated with a double-protein transition. The first transition corresponds to the replacement of histones by several spermatid-specific proteins (also called transition proteins) which are themselves replaced by protamines during the second transition. |
| GO process: | spermatogenesis (GO:0007283) |
| GO component: | nucleus (GO:0005634), nucleosome (GO:0000786) |
| GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP1