The domain within your query sequence starts at position 151 and ends at position 194; the E-value for the TPKR_C2 domain shown below is 4.9e-15.
HCSCALFWLQRWEQEGLCGVHTQTLHDSGPGDQFLPLGHNTSCG
TPKR_C2 |
 |
|---|
| PFAM accession number: | PF16920 |
|---|---|
| Interpro abstract (IPR031635): | In the tyrosine-protein kinase receptor NTRK1 (also known as Trka) this domain interacts with beta-nerve growth factor NGF [ (PUBMED:17196528) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPKR_C2