The domain within your query sequence starts at position 30 and ends at position 155; the E-value for the TPK_catalytic domain shown below is 2.4e-44.

ARFRHLWKKALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPEVKEYYTKKGCD
LISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGGRFDQIMASVNTLFQATHIT
PVPIII

TPK_catalytic

 TPK_catalytic
PFAM accession number:PF04263
Interpro abstract (IPR007371):

Thiamin pyrophosphokinase (TPK, EC 2.7.6.2 ) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggests that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis [ (PUBMED:11435118) ].

GO process:thiamine diphosphate biosynthetic process (GO:0009229)
GO function:thiamine diphosphokinase activity (GO:0004788), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPK_catalytic